PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 253aa    MW: 28385 Da    PI: 4.9314
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021542genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.11.6e-3991081100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCa C+++rrkC+++Cvlap fpa+qp  f+n+hklFG+ n+lk+lk+l+e+++++am+s++yeA++r + Pv+G++gv++++q q++q+++el+ + 
  DCAR_021542   9 ACARCRYQRRKCTSECVLAPFFPADQPTIFQNAHKLFGVGNILKILKDLDETQKTEAMKSIIYEANIREKFPVHGCLGVVMQYQYQIQQMQEELQIVL 106
                  7*********************************************************************************************9876 PP

       DUF260  99 ee 100
                  ++
  DCAR_021542 107 SQ 108
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9918109IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-379104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSKSGTNQAC ARCRYQRRKC TSECVLAPFF PADQPTIFQN AHKLFGVGNI LKILKDLDET  60
QKTEAMKSII YEANIREKFP VHGCLGVVMQ YQYQIQQMQE ELQIVLSQLA FWKQRLPRDD  120
PSQVLSGLSV TPVPQNAVDF YETQCINHVT LPIASDPLFF GSGNVSHDHV HGAGPYNGSY  180
NVVDSLRIQT DDNQMVQNQL QALNVQQDVV DEDYEFIDAI DDRQSLVDSK ETGQLSLDSR  240
VKDSRSLLGT LV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439670.13e-63hypothetical protein CICLE_v10021399mg
TrEMBLV4TMK43e-63V4TMK4_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-38LOB domain-containing protein 27